This website uses cookies to ensure you get the best experience on our website. Learn more

siapa bilang WILO ga hadir? ????WILONA dan VERREL NGREKAM moment RESEPSI FELITO barengan dan sejajar ????

x

FEBBY RASTANTY, VERRELL BRAMASTA & NATASHA WILONA KETEMU DI NIKAHAN CAESAR HITO DAN FELICYA

WOW FEBBY RASTANTY, VERRELL BRAMASTA & NATASHA WILONA KETEMU DI NIKAHANCAESAR HITO DAN FELICYA ANGELISTA
x

Ada Natasha Wilona, Verrell Bramasta Gandeng Febby Rastanty di Pernikahan Hito & Feli Bikin Bapperr

Hallo gaiz,ketemu lagi di channel ndyoco Info.
Kali ini saya akan memberikan info mengenai Ada Natasha Wilona, Verrell Bramasta Gandeng Febby Rastanty di Pernikahan Hito & Feli Bikin Bapperr !!

Sumber :



Tonton juga video lainnya :

Ada verrell bramasta dan Febby rastanty di pernikahan hito & felicya bikin bapperr


Live !! Ini perasaan Abidzar Dipasangkan dengan febby rastanty di film balada siroy


Live !! Ini perasaan febby rastanty di ajak main di film balada si roy Bikin Bapperr


Ini keseruan febby Rastanty di launching film barunya balada si roy :


Ada febby rastanty dan verrell bramasta di ulang tahun temennya:


Tapi sebelumnya jangan lupa SUBSCRIBE dan like video ini ya gaiz untuk membantu saya supaya bisa lebih berkarya lagi dan selalu memberikan video2 yg bermanfaat buat kalian.

Jangan lupa follow juga :

Instagram :
Facebook   : Ndy oco

For bisnis :
Email : rudi.ponco77@gmail.com
#verrellbramasta#febbyrastanty#baladasiroy
x

BISA JADI ini ALASAN STEFAN WILLIAM tidak hadir di pernikahan FELI dan HITO

#felito #stefanwilliamtidakhadirdipernikahanfelito #stefannatashawilona
x

siapa bilang WILO ga hadir? ????WILONA dan VERREL NGREKAM moment RESEPSI FELITO barengan dan sejajar ????

#wilver #natashawilona #verrelbramasta #weddingfelito #wilonaketemuverreldinikahanhitofeli
x

Natasha Wilona Dan Verrel Bramasta Terlihat Hadir Dipernikahan Caesar Hito Dan Fely Wilo Sangat Cntk

NASTASHA WILONA





Halo Teman Teman Para Artis Channel Semoga Kalian Sehat Selalu,
Jangan Lupa Subscribe Agar Teman Teman Tidak Ketinggalan Update Terbaru Dari Idola Teman Teman.




Natasha Wilona Dan Verrel Bramasta Terlihat Hadir Dipernikahan Caesar Hito Dan Fely Wilo Sangat Cntk







Terbaru Hari ini 2021.

Kegiatan Verrel Bramasta dari main tik tok bersama Ranty,olahraga dan makan bersama keluarga

VERREL JEMPUT FEBBY, BARENG KONDANGAN KE PERNIKAHAN FELITO, ternyata ketemu WILONA

#fever #febbyverrel #wilver #verrelketemuwilona #wilonaverrelbarengkondangan #febbyverrelbarengkondangan

Heboh, Verrell Bramasta & Natasha Wilona Dipertemukan Dalam Satu Acara | Intens Investigasi

Intens Investigasi, tayang setiap hari Senin - Jumat pukul 12.00 dan 18.00 WIB

Heboh pertemuan dua mantan, Natasha Wilona dan Verrell Bramasta di resepsi pernikahan Caesar Hito dan Felicya Angelista, kabarnya menghadirkan suasana penuh kebekuan. Hal itu kabarnya dipicu oleh hadirnya orang terdekat dari keduanya. Sebab pada momen itu, Verrell hadir ditemani Febby Rastanty, sedangkan Wilona yang tampak hadir ditemani oleh Ibundanya, juga berada dalam incaran Ferro Walandou, artis yang di penghujung tahun 2020 mengaku dekat dengan Wilona. Seperti apa suasana sebenarnya dari pertemuan Verrell dan Wilona di resepsi pernikahan Feli-Hito?? Benarkah keduanya sampai tidak bertegur sapa?? Seperti apa pula status Verrell dengan Febby Rastanty yang tampak masih lengket hingga kini?? Benarkah keduanya pacaran atau masih sahabatan?? Dan seperti apa pula sebenarnya kedekatan Ferro Walandou dengan Natasha Wilona, mengapa Ferro tampak masih malu-malu menggandeng Wilona di hadapan umum padahal dirinya mengaku sudah dekat dengan mantan kekasih Verrell Bramasta tersebut??

Saksikan semua di Intens Investigasi!
Jangan lupa Subscribe, Like, Share, dan Comment

Instagram :
Facebook :
Tiktok :

#VerrellBramasta #NatashaWilona

Verrel Datang Ke Pernikahan Felito Dengan Febby Untuk Buat Cemburu Wilona

Aktor Verrell Bramasta memang diketahui masih belum mempublish lagi kisah asmaranya pasca putus dari Natasha Wilona. Hanya saja kedekatan Verrell Bramasta dengan Febby Rastanty belakangan menjadi bahan perbincangan. Nah belum lama ini, Verrell Bramasta kembali dipertemukan dengan Natasha Wilona di pernikahan felito, mantan kekasih yang pernah ia pacari selama 2 tahun. apakah verrell ingin membuat cemburu wilona dengan menggandeng febby rastanty? simak video berikut
#natashawilona #febbyrastanty #verrellbramasta

HOT NEWS,WILLONA DAN VERREL DI PERTEMUKAN

HOT NEWS,WILLONA DAN VERREL DI PERTEMUKAN


hay anak band mania
budayakan menonton dan membaca sampai selesai dan seksama,supaya tidak gagal faham,terimakasih



#AnakBand
#SetefanWilliam
#NatashaWillona
#SuryaCitraTelevisi
#SCTV
#Sinemart
x

FISRT KISS FELICYA DAN HITO | FULL VIDEO RESEPSI PERNIKAHAN FELITO MERIAH

Hallo guys ????
aku sebagai bagian dari Felitolovers Indonesia sangat berbahagia atas Pernikahan kak Felicya dan kak Hito ❤️
Sebuah Teladan yang Indah yang telah diberikan oleh pasangan ini. Membangun Hubungan dengan menjaga kekudusan satu sama lain. Menjaga kekudusan memanglah tidak mudah, karena Ada begitu banyak tantangan dan kesempatan. Dan Tuhan telah menyatakan karyaNya didalam Mereka bahwa Bagi Tuhan tidak ada yang mustahil. Mereka berhasil Menjaga Kekudusan sampai Hari dimana mereka diberkati dalam Pernikahan Kudus. 9 Januari 2013 mereka dipertemukan, bukan suatu kebetulan tapi karena Tuhan Yesus mau pakai hidup mereka untuk menjadi Contoh dan Teladan bagi banyak Anak Muda. 8 tahun mereka bersama bukanlah Hal yang mudah dilakukan, tapi mereka dimampukan. Sampai pada akhirnya Sabtu tanggal 9 Januari 2021, mereka dipersatukan Oleh Bapa disurga dalam Pernikahan Kudus.
Kiranya Damai Sejahtera dari Tuhan Yesus memberkati Pernikahan Felicya dan Hito.

Terimakasih kepada semua pihak yang Ada didalam video ini, terimakasih untuk semua teman-teman yang sudah mendukung kelancaran Pernikahan Felito. God bless you all.

Mohon dukungan nyaa yaaa guys buat channel Youtube ini. Terimakasih untuk like, comments and Subscribe nya. God bless you

Note:
Makasih Buat temen temen yang telah Berpartisipasi dalam acara penikahan Hito & Felicyangelista Puji Tuhan Video pemberkatan nikah Yang di pimpin oleh Ps. Gilbert Lumoindong Treading Di YouTube Haleluya Ini Semua Berkat Kemurahan Tuhan Makasih Juga buat temen temen yang tidak berkomen menggukan emote kiranya berkat akan di curahkan ke kalian semua God Bless You All. #Felitolovers_Indonesia

Artis Cantik Natasha Wilona Dan Verrel Bramasta Serta Febby Di Pernikahan Caesarr Hito dan Felicyaaa

NASTASHA WILONA



Halo Teman Teman Para Artis Channel Semoga Kalian Sehat Selalu,
Jangan Lupa Subscribe Agar Teman Teman Tidak Ketinggalan Update Terbaru Dari Idola Teman Teman.


Artis Cantik Natasha Wilona Dan Verrel Bramasta Serta Febby Di Pernikahan Caesarr Hito dan Felicyaaa.




Terbaru Hari ini 2021.

VERREL ngucapin ultah untuk WILONA lwat VIDEOCALL. sweet bgt WILO ngash emot LOVE waktu mau nutup VC

#wilver #natashawilona #verrelbramasta #anakband #pupa

YES ROMANTIS ! NATASHA WILONA & VERREL BRAMAST BERDIRI BERDAMPINGAN DI ACARA FELI & HITO

#natashawilona#verrelbramasta#felihito#

BEST MOMENT NATASHA WILONA & VERREL BRAMASTA DI ACARA RESEPSI FELICYA & HITO

#natashawilona#verrelbramasta#
x

PRANK TIME !!!! VERRELL IKUTIN RANTY SELAMA DI LOKASI....MALAH ROMANTIS !!!!

BUSINESS ( DIGITAL ONLY )
VRL MANAGEMENT ( DIGI ) : +6281284290166 ( ADMIN )



thankyou for watching!!

Heboh!Verrell Bramasta Gandeng'Febby Rastanty'Di Acara nikahan Feli & Hito,Natasha Wilona Sendiri

Heboh!Verrell Bramasta Gandeng'Febby Rastanty'Di Acara nikahan Feli & Hito,Natasha Wilona Sendiri


Sumber:

Natasha willona ketemu Mantan di Pernikahan Feli dan Hito |walau sendiri wilona tetap cantik

natasha willona ketemu mantan
siapakah dia

#felihitowedding
#Natashawillona
#Felitogether
#Feliciaangelita
#hitofelinlove
#Caesarhito
#Wedding
#Nikahan
#Verrelbramasta

Lagi-Lagi Verrel Perlihatkan Kenangan Wilona Dibagian Tubuhnya, Romantis Banget

Foto Terbuka Dada Verrell Bramasta Disorot, Jumlah Tato yang Hiasi Tubuh Mantan Natasha Wilona

Kerap tampil rapi dengan pakaian serba modis, penampakan tato baru di bagian tubuh Verrell Bramasta yang jarang terlihat buat heboh netizen. Mantan kekasih Natasha Wilona itu memang selalu sukses menarik perhatian berkat raut wajah tampan dan tubuh atletis yang dimilikinya.

Selera berpakaian putra Venna Melinda itu pun selalu menjadi sorotan sering akibatnya dibalut dengan barang - barang bermerek mulai dari ujung kaki hingga ujung kepala.

Jarang luka bagian dalam tubuhnya, Verrell tiba - tiba saja membuat heboh netizen saat mengunggah beberapa foto bertelanjang dada yang menunjukkan secara jelas bentuk badannya di akun instagram, @bramastavrl, Sabtu (26/12/2020).

Selain bentuk tubuh, penampakan beberapa tato baru yang sengaja dipamerkan oleh Verrel di bagian badannya juga berhasil membuat heboh netizen pasalnya selama lawan main Ranty Maria itu tak pernah menunjukkannya.

Terhitung setidaknya ada empat tato yang terpampang di bagian tubuh Verrel dengan berbagai motif dan tulisan. tato tersebut terkenal di bagian belakang telinga kanan, dada kiri, lengan kiri dan dibawah pusat. Di Bagian belakang telinga kanan Verrell memiliki tato berbentuk simbol yang tidak diketahui maknanya.

Sementara dibagian dada ia mengisi kata karma, di bagian bawah pusat ia meletakan kata di tempat yang tepat, dan dibagian lengan kiri pesinetron muda itu menggambar tato dalam tulisan gunung dengan tulisan yang tidak terputus.

Banyak yang terkejut dengan aksi Verrell yang tiba - tiba saja memamerkan tato pada bagian tubuhnya yang selama ini jarang terekspose.Tak sedikit yang percaya bahwa tato dibagian tubuh Verrel itu merupakan tato sementara dan tato yang bersifat permanen.

#NatashaWilona #VerrelBramasta #SelebritiTv

Ternyta Hoaak Natasha Wilona Dikalahkan Lesti yang disebut ke 5 Tercantik Dunia Inul Angkat bicara

NASTASHA WILONA





Halo Teman Teman Para Artis Channel Semoga Kalian Sehat Selalu,
Jangan Lupa Subscribe Agar Teman Teman Tidak Ketinggalan Update Terbaru Dari Idola Teman Teman.




Ternyta Hoaak Natasha Wilona Dikalahkan Lesti yang disebut ke 5 Tercantik Dunia Inul Angkat bicara.







Terbaru Hari ini 2020.

Shares

x

Check Also

x

Menu